Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Protein TRIQK (Triqk)

This Recombinant Rat Protein TRIQK (Triqk) spans the amino acid sequence from region 1-86.

Product Specifications

Product Name Alternative

Protein TRIQK, Triple repetitive-sequence of QXXK/R protein homolog

UniProt

Q5EB66

Expression Region

1-86

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGRKDSSTTKLPVDQYRKQIGKQDYKKTKPILRATKLKAEAKKTAIGIKEVGLMLAAILA LLLAFYAFFYLRLSTNIDADLDPDED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hk3 (NM_001033245) Mouse Tagged ORF Clone Lentiviral Particle
MR223735L3V 200 µL

Hk3 (NM_001033245) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
SUV39H1 Polyclonal Antibody, Biotin Conjugated
bs-5708R-Biotin 100 µL

SUV39H1 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Human TCN2 Pre-designed siRNA Set B
SI016400B 1 Each

Human TCN2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
HEYL (Hairy/Enhancer-of-Split Related with YRPW Motif-like, HRT3, MGC12623, bHLHb33) (MaxLight 650)
247051-ML650 100 µL

HEYL (Hairy/Enhancer-of-Split Related with YRPW Motif-like, HRT3, MGC12623, bHLHb33) (MaxLight 650)

Sign In for Pricing
View Details
Olfr25 siRNA (m)
sc-150705 10 µM

Olfr25 siRNA (m)

Sign In for Pricing
View Details
C3orf32 (SSUH2) Human Gene Knockout Kit (CRISPR)
KN421805 1 Kit

C3orf32 (SSUH2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details