Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Protein TRIQK (TRIQK)

This Recombinant Pongo abelii Protein TRIQK (TRIQK) spans the amino acid sequence from region 1-86.

Product Specifications

Product Name Alternative

Protein TRIQK, Triple repetitive-sequence of QXXK/R protein homolog

UniProt

Q5RDR6

Expression Region

1-86

Origin

Pongo abelii (Sumatran orangutan)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGRKDAATIKLPVDQYRKQIGKQDYKKTKPILRATKLKAEAKKTAIGIKEVGLVLAAILA LLLAFYAFFYLRLTTDDDPDLDQDED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fish Prospero Homeobox Protein 1 (PROX1) ELISA Kit
MBS9356092 Inquire

Fish Prospero Homeobox Protein 1 (PROX1) ELISA Kit

Sign In for Pricing
View Details
Glucoallosamidin A
TN10225-01 10 mg

Glucoallosamidin A

Sign In for Pricing
View Details
Glucoallosamidin A
TN10225-02 50 mg

Glucoallosamidin A

Sign In for Pricing
View Details
MED6 (NM_005466) Human Tagged ORF Clone
RC202504 10 µg

MED6 (NM_005466) Human Tagged ORF Clone

Sign In for Pricing
View Details
INTS5 Rabbit pAb
E2506633 100 µL

INTS5 Rabbit pAb

Sign In for Pricing
View Details
ZNF313 Recombinant Protein Antigen
NBP1-87204PEP 0.1 mL

ZNF313 Recombinant Protein Antigen

Sign In for Pricing
View Details