Recombinant Pongo abelii Protein TRIQK (TRIQK)
This Recombinant Pongo abelii Protein TRIQK (TRIQK) spans the amino acid sequence from region 1-86.
Product Specifications
Product Name Alternative
Protein TRIQK, Triple repetitive-sequence of QXXK/R protein homolog
UniProt
Q5RDR6
Expression Region
1-86
Origin
Pongo abelii (Sumatran orangutan)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MGRKDAATIKLPVDQYRKQIGKQDYKKTKPILRATKLKAEAKKTAIGIKEVGLVLAAILA LLLAFYAFFYLRLTTDDDPDLDQDED
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
NB100-2707APCCY7 0.1 mL
Mouse Monoclonal HLA-DR Antibody (TAL 16.1) [Allophycocyanin/Cy7]
Sign In for Pricing
View Details 
248085-ML405 100 µL
LBX1 (ladybird Homeobox 1, HPX-6, HPX6, LBX1H, Homeobox) (MaxLight 405) discontinued
Sign In for Pricing
View Details