Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vibrio cholerae serotype O1 Probable oxaloacetate decarboxylase gamma chain 1 (oadG1)

This Recombinant Vibrio cholerae serotype O1 Probable oxaloacetate decarboxylase gamma chain 1 (oadG1) spans the amino acid sequence from region 1-86.

Product Specifications

Product Name Alternative

Probable oxaloacetate decarboxylase gamma chain 1, EC= 4.1.1.3

UniProt

Q9KUH2

Expression Region

1-86

Origin

Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTHIGSLLLDAATLMVTGMAVVFLFLTLLVYLVQFMSRVIPQEVPEAAATPKKSQKVQPV TDSVSPQVVAAIAAAVHQHRSATAKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 / ICAM3 (CG106), CF740 conjugate, 0.1mg/mL
BNC742216-100 1x 100 µL

CD50 / ICAM3 (CG106), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF647 conjugate, 0.1mg/mL
BNC470965-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL
BNC740204-100 1x 100 µL

Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF568 conjugate, 0.1mg/mL
BNC681429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF405S conjugate, 0.1mg/mL
BNC040437-500 1x 500 µL

CD47 (B6H12.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF594 conjugate, 0.1mg/mL
BNC940226-100 1x 100 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details