Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Exopolysaccharide production repressor protein (exoX)

This Recombinant Exopolysaccharide production repressor protein (exoX) spans the amino acid sequence from region 1-86.

Product Specifications

Product Name Alternative

Exopolysaccharide production repressor protein, Polysaccharide inhibition protein

UniProt

P14801

Expression Region

1-86

Origin

Rhizobium leguminosarum bv. phaseoli

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHQRCFGLRASLSIFKAFAVTLAASVFLQVVYFLSLLFMSFRPTRESDRSIHSGTRQADQ PQKRDRDKTEQSNVPKLDPRRKRRTP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Purified Anti-Human CD45 Antibody[HI30]
E-AB-F1137A-01 25 µg

Purified Anti-Human CD45 Antibody[HI30]

Sign In for Pricing
View Details
Purified Anti-Human CD45 Antibody[HI30]
E-AB-F1137A-02 100 µg

Purified Anti-Human CD45 Antibody[HI30]

Sign In for Pricing
View Details
Carnitinamide Chloride
TRC-C521881-50MG 50 mg

Carnitinamide Chloride

Sign In for Pricing
View Details
N,alpha-Diethylphenethylamine Hydrochloride
TRC-D444710-5MG 5 mg

N,alpha-Diethylphenethylamine Hydrochloride

Sign In for Pricing
View Details
GMP Human TGF-Beta 1 / TGFB1 Protein
GMP-TG1H25-500ug 500 µg

GMP Human TGF-Beta 1 / TGFB1 Protein

Sign In for Pricing
View Details
MIR1975 Human qPCR Primer Pair (MI0009985)
HP300220 200 Reactions

MIR1975 Human qPCR Primer Pair (MI0009985)

Sign In for Pricing
View Details