Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Exopolysaccharide production repressor protein (exoX)

This Recombinant Exopolysaccharide production repressor protein (exoX) spans the amino acid sequence from region 1-86.

Product Specifications

Product Name Alternative

Exopolysaccharide production repressor protein, Polysaccharide inhibition protein

UniProt

P14801

Expression Region

1-86

Origin

Rhizobium leguminosarum bv. phaseoli

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHQRCFGLRASLSIFKAFAVTLAASVFLQVVYFLSLLFMSFRPTRESDRSIHSGTRQADQ PQKRDRDKTEQSNVPKLDPRRKRRTP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM196 (NM_152774) Human Over-expression Lysate
LY403493 100 µg

TMEM196 (NM_152774) Human Over-expression Lysate

Sign In for Pricing
View Details
DHX36 (NM_020865) Human Recombinant Protein
TP323929M 100 µg

DHX36 (NM_020865) Human Recombinant Protein

Sign In for Pricing
View Details
EEF2K (NM_013302) Human Recombinant Protein
TP307496L 1 mg

EEF2K (NM_013302) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant ANGPTL1 Antibody
RN-14707-01 50 μL

Recombinant ANGPTL1 Antibody

Sign In for Pricing
View Details
Recombinant ANGPTL1 Antibody
RN-14707-02 100 µL

Recombinant ANGPTL1 Antibody

Sign In for Pricing
View Details
Recombinant ANGPTL1 Antibody
RN-14707-03 1 mL

Recombinant ANGPTL1 Antibody

Sign In for Pricing
View Details