Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein yubF (yubF)

This Recombinant Bacillus subtilis Uncharacterized membrane protein yubF (yubF) spans the amino acid sequence from region 1-87.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yubF

UniProt

O32082

Expression Region

1-87

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQKYRRRNTVAFTVLAYFTFFAGVFLFSIGLYNADNLELNEKGYYIAVMILVAVGAILTQ KVTRDNAEDNEIIAEQEKRQNQSHIES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Apolipoprotein E MAb (Clone 960318)
MAB41443-100 100 µg

Human Apolipoprotein E MAb (Clone 960318)

Sign In for Pricing
View Details
Closure Nalgene PP 2 port x38in
ASP2091 1 Each

Closure Nalgene PP 2 port x38in

Sign In for Pricing
View Details
CEBPB Antibody
E10-30258 100 µL

CEBPB Antibody

Sign In for Pricing
View Details
Guinea Pig Olfactory receptor 11H6 (OR11H6) ELISA kit
GTR10464796 96 Well

Guinea Pig Olfactory receptor 11H6 (OR11H6) ELISA kit

Sign In for Pricing
View Details
Arp2/ACTR2 Rabbit Polyclonal Antibody (Biotin)
orb2605944 100 µg

Arp2/ACTR2 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
2-Chloro-1-[4- (2-fluoro-phenyl) -piperazin-1-yl]-ethanone
sc-307334 500 mg

2-Chloro-1-[4- (2-fluoro-phenyl) -piperazin-1-yl]-ethanone

Sign In for Pricing
View Details