Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein yubF (yubF)

This Recombinant Bacillus subtilis Uncharacterized membrane protein yubF (yubF) spans the amino acid sequence from region 1-87.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yubF

UniProt

O32082

Expression Region

1-87

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQKYRRRNTVAFTVLAYFTFFAGVFLFSIGLYNADNLELNEKGYYIAVMILVAVGAILTQ KVTRDNAEDNEIIAEQEKRQNQSHIES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse PCIF1 siRNA
abx927953-01 15 nmol

Mouse PCIF1 siRNA

Sign In for Pricing
View Details
Mouse PCIF1 siRNA
abx927953-02 30 nmol

Mouse PCIF1 siRNA

Sign In for Pricing
View Details
Rabbit Polyclonal ARHGAP11A Antibody [Alexa Fluor 488]
NBP2-99558AF488 0.1 mL

Rabbit Polyclonal ARHGAP11A Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
OSMR Antibody
GWB-MQ445D 50 µg

OSMR Antibody

Sign In for Pricing
View Details
Rabbit anti-mouse Lysyl oxidase homolog 2 polyclonal Antibody, Biotin conjugated
MBS1495601-01 0.05 mg

Rabbit anti-mouse Lysyl oxidase homolog 2 polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details
Rabbit anti-mouse Lysyl oxidase homolog 2 polyclonal Antibody, Biotin conjugated
MBS1495601-02 0.1 mg

Rabbit anti-mouse Lysyl oxidase homolog 2 polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details