Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein yubF (yubF)

This Recombinant Bacillus subtilis Uncharacterized membrane protein yubF (yubF) spans the amino acid sequence from region 1-87.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yubF

UniProt

O32082

Expression Region

1-87

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQKYRRRNTVAFTVLAYFTFFAGVFLFSIGLYNADNLELNEKGYYIAVMILVAVGAILTQ KVTRDNAEDNEIIAEQEKRQNQSHIES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human anti-human GPIIb IgG
E4A11C86 50 µg

Human anti-human GPIIb IgG

Sign In for Pricing
View Details
Camk2b (NM_007595) Mouse Tagged ORF Clone
MG220945 10 µg

Camk2b (NM_007595) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Mouse IL-17RE (C-6His)
32-11222-50 50 µg

Recombinant Mouse IL-17RE (C-6His)

Sign In for Pricing
View Details
VRK1 Protein, Mouse, Recombinant (His & Myc)
TMPH-02899-01 5 µg

VRK1 Protein, Mouse, Recombinant (His & Myc)

Sign In for Pricing
View Details
VRK1 Protein, Mouse, Recombinant (His & Myc)
TMPH-02899-02 10 µg

VRK1 Protein, Mouse, Recombinant (His & Myc)

Sign In for Pricing
View Details
VRK1 Protein, Mouse, Recombinant (His & Myc)
TMPH-02899-03 20 µg

VRK1 Protein, Mouse, Recombinant (His & Myc)

Sign In for Pricing
View Details