Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus tropicalis Bladder cancer-associated protein (blcap)

This Recombinant Xenopus tropicalis Bladder cancer-associated protein (blcap) spans the amino acid sequence from region 1-87.

Product Specifications

Product Name Alternative

Bladder cancer-associated protein

UniProt

Q5M8I8

Expression Region

1-87

Origin

Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Field of Research

Cancer Biology; Kidney & Urological Research; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYCLQWLLPVLLIPKPLNPALWFSHSVFMGFYLLSFLLERKPCTICALVFLGALFLICYS CWGNCFLYHCSASELPEAAYDPAVVGT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8/18 (C-51), CF568 conjugate, 0.1mg/mL
BNC680034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF568 conjugate, 0.1mg/mL
BNC680253-100 1x 100 µL

Cytokeratin, LMW (AE-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF568 conjugate, 0.1mg/mL
BNC680009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF647 conjugate, 0.1mg/mL
BNC471035-100 1x 100 µL

CD8 (C8/1035), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2554), CF568 conjugate, 0.1mg/mL
BNC682554-500 1x 500 µL

Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2554), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TPO (Thyroid Peroxidase) (Thyroid Marker) (TPO/1922), CF647 conjugate, 0.1mg/mL
BNC471922-500 1x 500 µL

TPO (Thyroid Peroxidase) (Thyroid Marker) (TPO/1922), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details