Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis Bladder cancer-associated protein B (blcap-b)

This Recombinant Xenopus laevis Bladder cancer-associated protein B (blcap-b) spans the amino acid sequence from region 1-87.

Product Specifications

Product Name Alternative

Bladder cancer-associated protein B

UniProt

Q5EAT6

Expression Region

1-87

Origin

Xenopus laevis (African clawed frog)

Field of Research

Cancer Biology; Kidney & Urological Research; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYCLQWLLPVLLIPKPLNPALWFSHSVFMGFYLLSFLLERKPCTICALVFLGALFLICYS CWGNCFLYHCSASELPEAAYDPAVVGT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgG Immunoglobulin (IG266), CF594 conjugate, 0.1mg/mL
BNC940266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF488A conjugate, 0.1mg/mL
BNC880149-500 1x 500 µL

CD106 / VCAM1 (1.4C3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF568 conjugate, 0.1mg/mL
BNC680861-100 1x 100 µL

HSP27 (G3.1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF647 conjugate, 0.1mg/mL
BNC471231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF647 conjugate, 0.1mg/mL
BNC470152-100 1x 100 µL

CD11c (HC1/1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (DF1513), CF640R conjugate, 0.1mg/mL
BNC400188-100 1x 100 µL

CD71 (DF1513), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details