Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Bladder cancer-associated protein (BLCAP)

This Recombinant Pongo abelii Bladder cancer-associated protein (BLCAP) spans the amino acid sequence from region 1-87.

Product Specifications

Product Name Alternative

Bladder cancer-associated protein

UniProt

Q5R692

Expression Region

1-87

Origin

Pongo abelii (Sumatran orangutan)

Field of Research

Cancer Biology; Kidney & Urological Research; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYCLQWLLPVLLIPKPLNPALWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYS CWGNCFLYHCSDSPLPESAHDPGVVGT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (TV-1), CF568 conjugate, 0.1mg/mL
BNC680029-100 1x 100 µL

Fibronectin (TV-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
D-Xylonic Acid Calcium Salt Hydrate
TRC-X750000-2.5G 2.5 g

D-Xylonic Acid Calcium Salt Hydrate

Sign In for Pricing
View Details
(S)-N-Nitroso Anatabine-d4
TRC-N524747-5MG 5 mg

(S)-N-Nitroso Anatabine-d4

Sign In for Pricing
View Details
PPP1R3G (NM_001145115) Human Over-expression Lysate
LY428701 100 µg

PPP1R3G (NM_001145115) Human Over-expression Lysate

Sign In for Pricing
View Details
CD44v9 (Marker of Tumor Metastasis) (rCD44v9/1459), 0.2mg/mL
BNUB2345-500 1x 500 µL

CD44v9 (Marker of Tumor Metastasis) (rCD44v9/1459), 0.2mg/mL

Sign In for Pricing
View Details
Human SPATA22 activation kit by CRISPRa
GA113656 1 Kit

Human SPATA22 activation kit by CRISPRa

Sign In for Pricing
View Details