Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Bladder cancer-associated protein (BLCAP)

This Recombinant Pongo abelii Bladder cancer-associated protein (BLCAP) spans the amino acid sequence from region 1-87.

Product Specifications

Product Name Alternative

Bladder cancer-associated protein

UniProt

Q5R692

Expression Region

1-87

Origin

Pongo abelii (Sumatran orangutan)

Field of Research

Cancer Biology; Kidney & Urological Research; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYCLQWLLPVLLIPKPLNPALWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYS CWGNCFLYHCSDSPLPESAHDPGVVGT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® 647 Mouse IgG2a, κ Isotype Control[C1.18.4]
E-AB-F09803M-01 25 µg

Elab Fluor® 647 Mouse IgG2a, κ Isotype Control[C1.18.4]

Sign In for Pricing
View Details
Elab Fluor® 647 Mouse IgG2a, κ Isotype Control[C1.18.4]
E-AB-F09803M-02 100 µg

Elab Fluor® 647 Mouse IgG2a, κ Isotype Control[C1.18.4]

Sign In for Pricing
View Details
ZDHHC17 Rabbit Polyclonal Antibody
TA366768 100 µL

ZDHHC17 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
5-Acetyl-2-norbornene
TRC-A187150-2.5G 2.5 g

5-Acetyl-2-norbornene

Sign In for Pricing
View Details
Acvr2b Mouse Gene Knockout Kit (CRISPR)
KN500804 1 Kit

Acvr2b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
EHHADH Rabbit Polyclonal Antibody
TA375781 100 µL

EHHADH Rabbit Polyclonal Antibody

Sign In for Pricing
View Details