Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Uncharacterized protein YFR032C-B (YFR032C-B)

This Recombinant Saccharomyces cerevisiae Uncharacterized protein YFR032C-B (YFR032C-B) spans the amino acid sequence from region 1-87.

Product Specifications

Product Name Alternative

Uncharacterized protein YFR032C-B

UniProt

Q8TGU2

Expression Region

1-87

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVASRARENQRYSQCRKSTIFPLGFAIISGYIQFQNISILHISRFNPLFYNIFHSIFKNP GTTIQLESTLYYHEVPISPIGNAGSQI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TTL Antibody, Biotin conjugated
CSB-PA025252LD01HU-01 50 µg

TTL Antibody, Biotin conjugated

Sign In for Pricing
View Details
TTL Antibody, Biotin conjugated
CSB-PA025252LD01HU-02 100 µg

TTL Antibody, Biotin conjugated

Sign In for Pricing
View Details
Recombinant human Hydroxyacylglutathione hydrolase, mitochondrial
OPCA00898-1MG 1 mg

Recombinant human Hydroxyacylglutathione hydrolase, mitochondrial

Sign In for Pricing
View Details
TM9SF4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
46808111 3x 1.0 µg

TM9SF4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Mouse Arhgap8 (NM_028455) AAV Particle
MR217333A1V 250 µL

Mouse Arhgap8 (NM_028455) AAV Particle

Sign In for Pricing
View Details
SPTLC1 (H-1) Alexa Fluor® 647
sc-374143 AF647 200 µg/mL

SPTLC1 (H-1) Alexa Fluor® 647

Sign In for Pricing
View Details