Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Uncharacterized protein YFR032C-B (YFR032C-B)

This Recombinant Saccharomyces cerevisiae Uncharacterized protein YFR032C-B (YFR032C-B) spans the amino acid sequence from region 1-87.

Product Specifications

Product Name Alternative

Uncharacterized protein YFR032C-B

UniProt

Q8TGU2

Expression Region

1-87

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVASRARENQRYSQCRKSTIFPLGFAIISGYIQFQNISILHISRFNPLFYNIFHSIFKNP GTTIQLESTLYYHEVPISPIGNAGSQI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB5B Antibody
orb3160598-01 50 µL

RAB5B Antibody

Sign In for Pricing
View Details
RAB5B Antibody
orb3160598-02 100 µL

RAB5B Antibody

Sign In for Pricing
View Details
Purg sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3550406 1.0 µg DNA

Purg sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Rabbit Polyclonal JNK2 Antibody [Alexa Fluor 488]
NBP2-99547AF488 0.1 mL

Rabbit Polyclonal JNK2 Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Signaling Lymphocytic Activation Moleule Family, Member 1 (SLAMF1)
MBS2143578-01 0.1 mL

FITC-Linked Monoclonal Antibody to Signaling Lymphocytic Activation Moleule Family, Member 1 (SLAMF1)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Signaling Lymphocytic Activation Moleule Family, Member 1 (SLAMF1)
MBS2143578-02 0.2 mL

FITC-Linked Monoclonal Antibody to Signaling Lymphocytic Activation Moleule Family, Member 1 (SLAMF1)

Sign In for Pricing
View Details