Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Uncharacterized protein YFR032C-B (YFR032C-B)

This Recombinant Saccharomyces cerevisiae Uncharacterized protein YFR032C-B (YFR032C-B) spans the amino acid sequence from region 1-87.

Product Specifications

Product Name Alternative

Uncharacterized protein YFR032C-B

UniProt

Q8TGU2

Expression Region

1-87

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVASRARENQRYSQCRKSTIFPLGFAIISGYIQFQNISILHISRFNPLFYNIFHSIFKNP GTTIQLESTLYYHEVPISPIGNAGSQI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Haemophilus Influenzae ureA Protein (aa 1-100) (strain PittEE)
VAng-Lsx03938-500gEcoli 500 µg (E. coli)

Recombinant Haemophilus Influenzae ureA Protein (aa 1-100) (strain PittEE)

Sign In for Pricing
View Details
Rabbit Polyclonal Creatine kinase MT 1A Antibody
NBP3-05671-20ul 20 µL

Rabbit Polyclonal Creatine kinase MT 1A Antibody

Sign In for Pricing
View Details
Mal sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
27968116 3x 1.0 µg

Mal sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Neurl1b (NM_001081656) Mouse Tagged Lenti ORF Clone
MR219332L3 10 µg

Neurl1b (NM_001081656) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
MRPS18A Polyclonal Antibody
MBS9236418-01 0.1 mL

MRPS18A Polyclonal Antibody

Sign In for Pricing
View Details
MRPS18A Polyclonal Antibody
MBS9236418-02 5x 0.1 mL

MRPS18A Polyclonal Antibody

Sign In for Pricing
View Details