Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Holin (xhlB)

This Recombinant Bacillus subtilis Holin (xhlB) spans the amino acid sequence from region 1-87.

Product Specifications

Product Name Alternative

Holin

UniProt

Q99163

Expression Region

1-87

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNTFDKGTVIRTVLLLIALINQTMLMLGKSPLDIQEEQVNQLADALYSAGSIAFTIGTTL AAWFKNNYVTEKGKKQRDLLRDNNLTK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prefilled 2.0ml tubes, 6 mm Ceria Based Zirconium Oxide Satellite, 50pk
D1032-60 1 Each

Prefilled 2.0ml tubes, 6 mm Ceria Based Zirconium Oxide Satellite, 50pk

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS629495 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
ZNF583 (NM_001159860) Human Over-expression Lysate
LC431991 20 µg

ZNF583 (NM_001159860) Human Over-expression Lysate

Sign In for Pricing
View Details
Human CD30 Antibody Pair Set
E-KAB-0417 50 µL & 100 µg

Human CD30 Antibody Pair Set

Sign In for Pricing
View Details
N-(2,3-Dichlorophenyl)piperazine-d8 hydrochloride
TRC-D435752-50MG 50 mg

N-(2,3-Dichlorophenyl)piperazine-d8 hydrochloride

Sign In for Pricing
View Details
PAGE1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3D7]
TA805647BM 100 µL

PAGE1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3D7]

Sign In for Pricing
View Details