Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Holin (xhlB)

This Recombinant Bacillus subtilis Holin (xhlB) spans the amino acid sequence from region 1-87.

Product Specifications

Product Name Alternative

Holin

UniProt

Q99163

Expression Region

1-87

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNTFDKGTVIRTVLLLIALINQTMLMLGKSPLDIQEEQVNQLADALYSAGSIAFTIGTTL AAWFKNNYVTEKGKKQRDLLRDNNLTK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sodium Decyl Sulfate
TRC-S224595-5G 5 g

Sodium Decyl Sulfate

Sign In for Pricing
View Details
Mouse Gja5 activation kit by CRISPRa
GA201615 1 Kit

Mouse Gja5 activation kit by CRISPRa

Sign In for Pricing
View Details
IGFBP7 (NM_001553) Human Over-expression Lysate
LC419862 20 µg

IGFBP7 (NM_001553) Human Over-expression Lysate

Sign In for Pricing
View Details
MBD4 Rabbit Polyclonal Antibody
TA361260 100 µL

MBD4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RPL17 Antibody
8C14153-AAT 50 µg

RPL17 Antibody

Sign In for Pricing
View Details
p-Aminophenyl 6-phospho-a-D-mannopyranoside Sodium Salt
TRC-A357730-5MG 5 mg

p-Aminophenyl 6-phospho-a-D-mannopyranoside Sodium Salt

Sign In for Pricing
View Details