Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Holin (xhlB)

This Recombinant Bacillus subtilis Holin (xhlB) spans the amino acid sequence from region 1-87.

Product Specifications

Product Name Alternative

Holin

UniProt

Q99163

Expression Region

1-87

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNTFDKGTVIRTVLLLIALINQTMLMLGKSPLDIQEEQVNQLADALYSAGSIAFTIGTTL AAWFKNNYVTEKGKKQRDLLRDNNLTK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTLA4 / CD152 (Negative Regulator of T-Cells) (L4P2F5.F10), CF488A conjugate, 0.1mg/mL
BNC881696-500 1x 500 µL

CTLA4 / CD152 (Negative Regulator of T-Cells) (L4P2F5.F10), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Pleura
CR561288 5 µg

Tissue Total RNA, Pleura

Sign In for Pricing
View Details
Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2039), CF740 conjugate, 0.1mg/mL
BNC742039-500 1x 500 µL

Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2039), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Filensin (BFSP1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F4]
TA804044BM 100 µL

Filensin (BFSP1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F4]

Sign In for Pricing
View Details
5HT1E Receptor (HTR1E) (NM_000865) Human Over-expression Lysate
LC424479 20 µg

5HT1E Receptor (HTR1E) (NM_000865) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Lymphocyte Antigen 6 Complex (LY6K) activation kit by CRISPRa
GA110238 1 Kit

Human Lymphocyte Antigen 6 Complex (LY6K) activation kit by CRISPRa

Sign In for Pricing
View Details