Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gallid herpesvirus 2 Uncharacterized gene 86 protein (MDV086)

This Recombinant Gallid herpesvirus 2 Uncharacterized gene 86 protein (MDV086) spans the amino acid sequence from region 1-87.

Product Specifications

Product Name Alternative

Uncharacterized gene 86 protein

UniProt

Q9DGY2

Expression Region

1-87

Origin

Gallid herpesvirus 2 (strain Chicken/Md5/ATCC VR-987) (GaHV-2) (Marek's disease herpesvirus type 1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSWPRGDSKKKKIEGGETLLDNRVARPHHILPLPQIQNCIRERRKKKGIYIPHTLIFWMC PRAMGTAITFEFLQPKAQPRVHRDSPT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olutasidenib
TRC-O299810-50MG 50 mg

Olutasidenib

Sign In for Pricing
View Details
Cytokeratin 5 (KRT5) (Basal, Myoepithelial & Mesothelial Cell Marker) (KRT5/3594), CF647 conjugate, 0.1mg/mL
BNC473594-100 1x 100 µL

Cytokeratin 5 (KRT5) (Basal, Myoepithelial & Mesothelial Cell Marker) (KRT5/3594), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
3beta-Dihydroxy-19-norandrost-5(10)-ene
TRC-D499330-250MG 250 mg

3beta-Dihydroxy-19-norandrost-5(10)-ene

Sign In for Pricing
View Details
CD3e (Rabbit PAb), CF405S conjugate, 0.1mg/mL
BNC040385-500 1x 500 µL

CD3e (Rabbit PAb), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Niemann Pick C1 (NPC1) Human Gene Knockout Kit (CRISPR)
KN209258LP 1 Kit

Niemann Pick C1 (NPC1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BIGM103 (SLC39A8) (NM_001135146) Human Over-expression Lysate
LY427559 100 µg

BIGM103 (SLC39A8) (NM_001135146) Human Over-expression Lysate

Sign In for Pricing
View Details