Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gallid herpesvirus 2 Uncharacterized gene 86 protein (MDV086)

This Recombinant Gallid herpesvirus 2 Uncharacterized gene 86 protein (MDV086) spans the amino acid sequence from region 1-87.

Product Specifications

Product Name Alternative

Uncharacterized gene 86 protein

UniProt

Q9DGY2

Expression Region

1-87

Origin

Gallid herpesvirus 2 (strain Chicken/Md5/ATCC VR-987) (GaHV-2) (Marek's disease herpesvirus type 1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSWPRGDSKKKKIEGGETLLDNRVARPHHILPLPQIQNCIRERRKKKGIYIPHTLIFWMC PRAMGTAITFEFLQPKAQPRVHRDSPT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EBFP Mouse Monoclonal Antibody [Clone ID: 3A6]
AM32008PU-N 100 µg

EBFP Mouse Monoclonal Antibody [Clone ID: 3A6]

Sign In for Pricing
View Details
AATOM™ 610 maleimide
70252-AAT 1 mg

AATOM™ 610 maleimide

Sign In for Pricing
View Details
CA5B Antibody
KC-7313-01 50 μL

CA5B Antibody

Sign In for Pricing
View Details
CA5B Antibody
KC-7313-02 100 µL

CA5B Antibody

Sign In for Pricing
View Details
CA5B Antibody
KC-7313-03 1 mL

CA5B Antibody

Sign In for Pricing
View Details
Stx3 Mouse Gene Knockout Kit (CRISPR)
KN516930 1 Kit

Stx3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details