Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gallid herpesvirus 2 Uncharacterized gene 86 protein (MDV086)

This Recombinant Gallid herpesvirus 2 Uncharacterized gene 86 protein (MDV086) spans the amino acid sequence from region 1-87.

Product Specifications

Product Name Alternative

Uncharacterized gene 86 protein

UniProt

Q9DGY2

Expression Region

1-87

Origin

Gallid herpesvirus 2 (strain Chicken/Md5/ATCC VR-987) (GaHV-2) (Marek's disease herpesvirus type 1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSWPRGDSKKKKIEGGETLLDNRVARPHHILPLPQIQNCIRERRKKKGIYIPHTLIFWMC PRAMGTAITFEFLQPKAQPRVHRDSPT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Prostate
CS700021 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
5,6-Dichlorobenzimidazole
TRC-D431900-250MG 250 mg

5,6-Dichlorobenzimidazole

Sign In for Pricing
View Details
Uncoated Mouse CCL6 (Chemokine C-C-Motif Ligand 6) ELISA Kit
E-UNEL-M0087-01 5x 96 Tests

Uncoated Mouse CCL6 (Chemokine C-C-Motif Ligand 6) ELISA Kit

Sign In for Pricing
View Details
Uncoated Mouse CCL6 (Chemokine C-C-Motif Ligand 6) ELISA Kit
E-UNEL-M0087-02 15x 96 Tests

Uncoated Mouse CCL6 (Chemokine C-C-Motif Ligand 6) ELISA Kit

Sign In for Pricing
View Details
CD44 Antibody
KC-871-01 50 μL

CD44 Antibody

Sign In for Pricing
View Details
CD44 Antibody
KC-871-02 100 µL

CD44 Antibody

Sign In for Pricing
View Details