Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Bladder cancer-associated protein (BLCAP)

This Recombinant Human Bladder cancer-associated protein (BLCAP) spans the amino acid sequence from region 1-87.

Product Specifications

Product Name Alternative

Bladder cancer-associated protein, Bladder cancer 10 kDa protein, Bc10

UniProt

P62952

Expression Region

1-87

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology; Kidney & Urological Research; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYCLQWLLPVLLIPKPLNPALWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYS CWGNCFLYHCSDSPLPESAHDPGVVGT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cryptochrome I (CRY1) (NM_004075) Human Over-expression Lysate
LY418241 100 µg

Cryptochrome I (CRY1) (NM_004075) Human Over-expression Lysate

Sign In for Pricing
View Details
1-Hexacosanol
TRC-H290920-50MG 50 mg

1-Hexacosanol

Sign In for Pricing
View Details
SLC22A12 (NM_144585) Human Over-expression Lysate
LC403397 20 µg

SLC22A12 (NM_144585) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS504135 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
IFI16 Rabbit Polyclonal Antibody
TA371911 100 µL

IFI16 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Thiol Microplate Assay Kit
RDSM146 100 Assays

Thiol Microplate Assay Kit

Sign In for Pricing
View Details