Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Bladder cancer-associated protein (BLCAP)

This Recombinant Human Bladder cancer-associated protein (BLCAP) spans the amino acid sequence from region 1-87.

Product Specifications

Product Name Alternative

Bladder cancer-associated protein, Bladder cancer 10 kDa protein, Bc10

UniProt

P62952

Expression Region

1-87

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology; Kidney & Urological Research; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYCLQWLLPVLLIPKPLNPALWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYS CWGNCFLYHCSDSPLPESAHDPGVVGT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XPNPEP1 (NM_001167604) Human Over-expression Lysate
LY433385 100 µg

XPNPEP1 (NM_001167604) Human Over-expression Lysate

Sign In for Pricing
View Details
C14orf184 (NM_001080113) Human Over-expression Lysate
LC421584 20 µg

C14orf184 (NM_001080113) Human Over-expression Lysate

Sign In for Pricing
View Details
Human BLOC1S3 activation kit by CRISPRa
GA117965 1 Kit

Human BLOC1S3 activation kit by CRISPRa

Sign In for Pricing
View Details
Ciclopirox Ethanolamine
TRC-C432805-50MG 50 mg

Ciclopirox Ethanolamine

Sign In for Pricing
View Details
EBAG9 (NM_004215) Human Recombinant Protein
TP305364M 100 µg

EBAG9 (NM_004215) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Duodenum
CS701065 5x 5 µm

Tissue FFPE Sections, Duodenum

Sign In for Pricing
View Details