Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Bladder cancer-associated protein (Blcap)

This Recombinant Rat Bladder cancer-associated protein (Blcap) spans the amino acid sequence from region 1-87.

Product Specifications

Product Name Alternative

Bladder cancer-associated protein, Bladder cancer 10 kDa protein, Bc10

UniProt

P62950

Expression Region

1-87

Origin

Rattus norvegicus (Rat)

Field of Research

Cancer Biology; Kidney & Urological Research; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYCLQWLLPVLLIPKPLNPALWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYS CWGNCFLYHCSDSPLPESAHDPGVVGT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MUC15 activation kit by CRISPRa
GA115466 1 Kit

Human MUC15 activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse Dgcr6 activation kit by CRISPRa
GA201065 1 Kit

Mouse Dgcr6 activation kit by CRISPRa

Sign In for Pricing
View Details
D,L-Mevalonic Acid Dicyclohexylammonium Salt
TRC-M339020-500MG 500 mg

D,L-Mevalonic Acid Dicyclohexylammonium Salt

Sign In for Pricing
View Details
Frozen Tissue Sections, Myeloid tissue
CS627746 5x 5 µm

Frozen Tissue Sections, Myeloid tissue

Sign In for Pricing
View Details
APC Anti-Mouse CD119 Antibody[GR-20]
E-AB-F1115E-01 50 Tests

APC Anti-Mouse CD119 Antibody[GR-20]

Sign In for Pricing
View Details
APC Anti-Mouse CD119 Antibody[GR-20]
E-AB-F1115E-02 100 Tests

APC Anti-Mouse CD119 Antibody[GR-20]

Sign In for Pricing
View Details