Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Bladder cancer-associated protein (Blcap)

This Recombinant Rat Bladder cancer-associated protein (Blcap) spans the amino acid sequence from region 1-87.

Product Specifications

Product Name Alternative

Bladder cancer-associated protein, Bladder cancer 10 kDa protein, Bc10

UniProt

P62950

Expression Region

1-87

Origin

Rattus norvegicus (Rat)

Field of Research

Cancer Biology; Kidney & Urological Research; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYCLQWLLPVLLIPKPLNPALWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYS CWGNCFLYHCSDSPLPESAHDPGVVGT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aflatoxin G2
TRC-A357485-5MG 5 mg

Aflatoxin G2

Sign In for Pricing
View Details
TMCO1 (NM_019026) Human Over-expression Lysate
LC402729 20 µg

TMCO1 (NM_019026) Human Over-expression Lysate

Sign In for Pricing
View Details
Cyclin E2 Recombinant Rabbit Monoclonal Antibody [SD2035]
ET1612-17 100 µL

Cyclin E2 Recombinant Rabbit Monoclonal Antibody [SD2035]

Sign In for Pricing
View Details
AquaphileTM Coelenterazine Native, lyophilized solid
#10126-50ug 1x 50 µg

AquaphileTM Coelenterazine Native, lyophilized solid

Sign In for Pricing
View Details
Pigment Orange 13 (Technical Grade)
TRC-P437813-50G 50 g

Pigment Orange 13 (Technical Grade)

Sign In for Pricing
View Details
Erlenmeyer Flasks
F4062-B 12 Units/Case

Erlenmeyer Flasks

Sign In for Pricing
View Details