Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Bladder cancer-associated protein (Blcap)

This Recombinant Rat Bladder cancer-associated protein (Blcap) spans the amino acid sequence from region 1-87.

Product Specifications

Product Name Alternative

Bladder cancer-associated protein, Bladder cancer 10 kDa protein, Bc10

UniProt

P62950

Expression Region

1-87

Origin

Rattus norvegicus (Rat)

Field of Research

Cancer Biology; Kidney & Urological Research; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYCLQWLLPVLLIPKPLNPALWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYS CWGNCFLYHCSDSPLPESAHDPGVVGT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Flutrimazole
TRC-F622000-500MG 500 mg

Flutrimazole

Sign In for Pricing
View Details
Human BRCC36 (BRCC3) activation kit by CRISPRa
GA112410 1 Kit

Human BRCC36 (BRCC3) activation kit by CRISPRa

Sign In for Pricing
View Details
CF®405S Rabbit Anti-DNP, 2 mg/mL
#20865-250uL 1x 250 µL

CF®405S Rabbit Anti-DNP, 2 mg/mL

Sign In for Pricing
View Details
3110040N11Rik Mouse Gene Knockout Kit (CRISPR)
KN500313 1 Kit

3110040N11Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
O-(Octadecylphosphoryl)choline
TRC-O596260-500MG 500 mg

O-(Octadecylphosphoryl)choline

Sign In for Pricing
View Details
NOS1 Rabbit Polyclonal Antibody
AP09502PU-S 50 µL

NOS1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details