Recombinant Cat Bladder cancer-associated protein (BLCAP)
This Recombinant Cat Bladder cancer-associated protein (BLCAP) spans the amino acid sequence from region 1-87.
Product Specifications
Product Name Alternative
Bladder cancer-associated protein, Bladder cancer 10 kDa protein, Bc10
UniProt
P62953
Expression Region
1-87
Origin
Felis catus (Cat) (Felis silvestris catus)
Field of Research
Cancer Biology; Metabolism Research; Kidney & Urological Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MYCLQWLLPVLLIPKPLNPALWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYS CWGNCFLYHCSDSPLPESAHDPGVVGT
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6312774-01 0.2 mL
KCNT2, CT (KCNT2, SLICK, Potassium channel subfamily T member 2, Sequence like an intermediate conductance potassium channel subunit, Sodium and chloride-activated ATP-sensitive potassium channel Slo2.1) (PE)
Sign In for Pricing
View Details MBS6312774-02 5x 0.2 mL
KCNT2, CT (KCNT2, SLICK, Potassium channel subfamily T member 2, Sequence like an intermediate conductance potassium channel subunit, Sodium and chloride-activated ATP-sensitive potassium channel Slo2.1) (PE)
Sign In for Pricing
View Details