Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Bladder cancer-associated protein (Blcap)

This Recombinant Mouse Bladder cancer-associated protein (Blcap) spans the amino acid sequence from region 1-87.

Product Specifications

Product Name Alternative

Bladder cancer-associated protein, Bladder cancer 10 kDa protein, Bc10

UniProt

P62951

Expression Region

1-87

Origin

Mus musculus (Mouse)

Field of Research

Cancer Biology; Kidney & Urological Research; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYCLQWLLPVLLIPKPLNPALWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYS CWGNCFLYHCSDSPLPESAHDPGVVGT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALDH1A1 Recombinant Mouse monoclonal Antibody
HA610093 100 µg

ALDH1A1 Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 14 (KRT14/532), CF647 conjugate, 0.1mg/mL
BNC470532-500 1x 500 µL

Cytokeratin 14 (KRT14/532), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thymidine 5'-Diphosphate Trisodium Salt
TRC-T077195-50MG 50 mg

Thymidine 5'-Diphosphate Trisodium Salt

Sign In for Pricing
View Details
MAP9 (NM_001039580) Human Over-expression Lysate
LC422080 20 µg

MAP9 (NM_001039580) Human Over-expression Lysate

Sign In for Pricing
View Details
RNF214 Rabbit Polyclonal Antibody
TA361028 100 µL

RNF214 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ivacaftor (4-tertbutyl-d9) (Major)
TRC-I940603-5MG 5 mg

Ivacaftor (4-tertbutyl-d9) (Major)

Sign In for Pricing
View Details