Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Bladder cancer-associated protein (Blcap)

This Recombinant Mouse Bladder cancer-associated protein (Blcap) spans the amino acid sequence from region 1-87.

Product Specifications

Product Name Alternative

Bladder cancer-associated protein, Bladder cancer 10 kDa protein, Bc10

UniProt

P62951

Expression Region

1-87

Origin

Mus musculus (Mouse)

Field of Research

Cancer Biology; Kidney & Urological Research; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYCLQWLLPVLLIPKPLNPALWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYS CWGNCFLYHCSDSPLPESAHDPGVVGT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mefenorex Hydrochloride
TRC-M205200-25MG 25 mg

Mefenorex Hydrochloride

Sign In for Pricing
View Details
CD63 (Late Endosomes Marker) (LAMP3/2990R), Biotin conjugate, 0.1mg/mL
BNCB2990-500 1x 500 µL

CD63 (Late Endosomes Marker) (LAMP3/2990R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tide Quencher™ 7.2WS amine [TQ7.2WS amine]
2123-AAT 1 mg

Tide Quencher™ 7.2WS amine [TQ7.2WS amine]

Sign In for Pricing
View Details
Green Fluorescent FAM-DEVD-OPH in vitro caspase-3/7 Apoptosis Detection Reagent
6356 4x 37.5 µg Vials

Green Fluorescent FAM-DEVD-OPH in vitro caspase-3/7 Apoptosis Detection Reagent

Sign In for Pricing
View Details
CD44 / HCAM Std. (Cancer Stem Cell Marker) (rHCAM/918), CF405S conjugate, 0.1mg/mL
BNC043438-100 1x 100 µL

CD44 / HCAM Std. (Cancer Stem Cell Marker) (rHCAM/918), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Interleukin 10 (IL10) (Immunoregulation Marker) (IL10/2651R), CF647 conjugate, 0.1mg/mL
BNC472651-500 1x 500 µL

Interleukin 10 (IL10) (Immunoregulation Marker) (IL10/2651R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details