Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Bladder cancer-associated protein (Blcap)

This Recombinant Mouse Bladder cancer-associated protein (Blcap) spans the amino acid sequence from region 1-87.

Product Specifications

Product Name Alternative

Bladder cancer-associated protein, Bladder cancer 10 kDa protein, Bc10

UniProt

P62951

Expression Region

1-87

Origin

Mus musculus (Mouse)

Field of Research

Cancer Biology; Kidney & Urological Research; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYCLQWLLPVLLIPKPLNPALWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYS CWGNCFLYHCSDSPLPESAHDPGVVGT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spectrodensitometer BSDM-1304
BSDM-1304 1 Unit

Spectrodensitometer BSDM-1304

Sign In for Pricing
View Details
LIMS1 Mouse Monoclonal Antibody [Clone ID: 5G7]
AM06652SU-N 100 µL

LIMS1 Mouse Monoclonal Antibody [Clone ID: 5G7]

Sign In for Pricing
View Details
EASYStep Pro Canine Estriol (E3) ELISA Kit
RDEp-E3-c 96 Tests

EASYStep Pro Canine Estriol (E3) ELISA Kit

Sign In for Pricing
View Details
Human ZNF385C activation kit by CRISPRa
GA116381 1 Kit

Human ZNF385C activation kit by CRISPRa

Sign In for Pricing
View Details
UTP14A Antibody
8C11624-AAT 50 µg

UTP14A Antibody

Sign In for Pricing
View Details
Human Kappa Light Chain (HP6053), CF640R conjugate, 0.1mg/mL
BNC400681-100 1x 100 µL

Human Kappa Light Chain (HP6053), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details