Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Variola virus Protein L2 (L2R, M2R)

This Recombinant Variola virus Protein L2 (L2R, M2R) spans the amino acid sequence from region 1-87.

Product Specifications

Product Name Alternative

Protein L2

UniProt

P33041

Expression Region

1-87

Origin

Variola virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox virus)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEVIADRLDDIVKQNIADEKFVDFVIHGLEHQCPAILRPLIRLFIDILLFVIVIYIFTVR LVSRNYQMLLALLALVISLTIFYYFIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mannual Solid Phase Extraction System BSPE-102
BSPE-102 1 Unit

Mannual Solid Phase Extraction System BSPE-102

Sign In for Pricing
View Details
Recombinant Mouse IL-17 RA/IL-17 R Protein (Fc Tag)
PDMM100153-01 20 µg

Recombinant Mouse IL-17 RA/IL-17 R Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse IL-17 RA/IL-17 R Protein (Fc Tag)
PDMM100153-02 100 µg

Recombinant Mouse IL-17 RA/IL-17 R Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse IL-17 RA/IL-17 R Protein (Fc Tag)
PDMM100153-03 500 µg

Recombinant Mouse IL-17 RA/IL-17 R Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse IL-17 RA/IL-17 R Protein (Fc Tag)
PDMM100153-04 1 mg

Recombinant Mouse IL-17 RA/IL-17 R Protein (Fc Tag)

Sign In for Pricing
View Details
Sdr16c5 Mouse Gene Knockout Kit (CRISPR)
KN515439 1 Kit

Sdr16c5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details