Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein ZK1098.9 (ZK1098.9)

This Recombinant Uncharacterized protein ZK1098.9 (ZK1098.9) spans the amino acid sequence from region 1-87.

Product Specifications

Product Name Alternative

Uncharacterized protein ZK1098.9

UniProt

P34608

Expression Region

1-87

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEKHFILPSSMLMIVSAVFGGIGIITTIVFVILTVLHSKSAVCKPAGKEDMKKLNGIEG MQTIKEECGGSTETSSSKPKKKAKKEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Brca1 Mouse Gene Knockout Kit (CRISPR)
KN302248 1 Kit

Brca1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CF410 Succinimidyl Ester (Pacific Blue Succinimidyl Ester)
#97502 1x 5 mg

CF410 Succinimidyl Ester (Pacific Blue Succinimidyl Ester)

Sign In for Pricing
View Details
Glypican 3 (GPC3) Human Gene Knockout Kit (CRISPR)
KN205911RB 1 Kit

Glypican 3 (GPC3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
P63 (Squamous, Basal and Myoepithelial Cell Marker) (TP63/1786), CF488A conjugate, 0.1mg/mL
BNC881786-500 1x 500 µL

P63 (Squamous, Basal and Myoepithelial Cell Marker) (TP63/1786), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human FGFBP3 activation kit by CRISPRa
GA115454 1 Kit

Human FGFBP3 activation kit by CRISPRa

Sign In for Pricing
View Details
BCLW Antibody
8C13031-AAT 50 µg

BCLW Antibody

Sign In for Pricing
View Details