Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein ZK1098.9 (ZK1098.9)

This Recombinant Uncharacterized protein ZK1098.9 (ZK1098.9) spans the amino acid sequence from region 1-87.

Product Specifications

Product Name Alternative

Uncharacterized protein ZK1098.9

UniProt

P34608

Expression Region

1-87

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEKHFILPSSMLMIVSAVFGGIGIITTIVFVILTVLHSKSAVCKPAGKEDMKKLNGIEG MQTIKEECGGSTETSSSKPKKKAKKEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

alpha 1 Catenin (CTNNA1) pSer641 Rabbit Polyclonal Antibody
AP09467PU-N 100 µL

alpha 1 Catenin (CTNNA1) pSer641 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS702771 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Recombinant Granulin Antibody
RC-6648-01 50 μL

Recombinant Granulin Antibody

Sign In for Pricing
View Details
Recombinant Granulin Antibody
RC-6648-02 100 µL

Recombinant Granulin Antibody

Sign In for Pricing
View Details
Recombinant Granulin Antibody
RC-6648-03 1 mL

Recombinant Granulin Antibody

Sign In for Pricing
View Details
GOLGA6 (GOLGA6A) (NM_001038640) Human Over-expression Lysate
LY422006 100 µg

GOLGA6 (GOLGA6A) (NM_001038640) Human Over-expression Lysate

Sign In for Pricing
View Details