Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Spore morphogenesis and germination protein ywcE (ywcE)

This Recombinant Bacillus subtilis Spore morphogenesis and germination protein ywcE (ywcE) spans the amino acid sequence from region 1-87.

Product Specifications

Product Name Alternative

Spore morphogenesis and germination protein ywcE

UniProt

P39603

Expression Region

1-87

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMDMFFAYLLVASATPLFIWLDNKKVALSAIPPIILMWVFFFFYATESLSPLGHTLMIIL FAVNVIVAHIAAFIIYGLPYLRRKRSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

c Kit (KIT) pTyr721 Rabbit Polyclonal Antibody
AP02495PU-S 50 µL

c Kit (KIT) pTyr721 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TEK Polyclonal Antibody
E-AB-12907-01 20 µL

TEK Polyclonal Antibody

Sign In for Pricing
View Details
TEK Polyclonal Antibody
E-AB-12907-02 60 µL

TEK Polyclonal Antibody

Sign In for Pricing
View Details
TEK Polyclonal Antibody
E-AB-12907-03 120 µL

TEK Polyclonal Antibody

Sign In for Pricing
View Details
TEK Polyclonal Antibody
E-AB-12907-04 200 µL

TEK Polyclonal Antibody

Sign In for Pricing
View Details
SCP1 (SYCP1) Rabbit Polyclonal Antibody
TA382228 100 µL

SCP1 (SYCP1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details