Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Spore morphogenesis and germination protein ywcE (ywcE)

This Recombinant Bacillus subtilis Spore morphogenesis and germination protein ywcE (ywcE) spans the amino acid sequence from region 1-87.

Product Specifications

Product Name Alternative

Spore morphogenesis and germination protein ywcE

UniProt

P39603

Expression Region

1-87

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMDMFFAYLLVASATPLFIWLDNKKVALSAIPPIILMWVFFFFYATESLSPLGHTLMIIL FAVNVIVAHIAAFIIYGLPYLRRKRSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-Amino-3-chloropicolinic Acid
TRC-A595920-250MG 250 mg

6-Amino-3-chloropicolinic Acid

Sign In for Pricing
View Details
Carboxypeptidase A2 (CPA2) (Center) Rabbit Polyclonal Antibody
AP51044PU-N 400 µL

Carboxypeptidase A2 (CPA2) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
(±)-Paraconic Acid
TRC-P191200-250MG 250 mg

(±)-Paraconic Acid

Sign In for Pricing
View Details
Cyclin E2 (CCNE2) (NM_057749) Human Over-expression Lysate
LY403299 100 µg

Cyclin E2 (CCNE2) (NM_057749) Human Over-expression Lysate

Sign In for Pricing
View Details
GPR84 (NM_020370) Human Over-expression Lysate
LC402776 20 µg

GPR84 (NM_020370) Human Over-expression Lysate

Sign In for Pricing
View Details
PPP2R5D Recombinant Rabbit monoclonal Antibody
HA750697 100 µL

PPP2R5D Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details