Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Helicobacter pylori Flagellar biosynthetic protein FliQ (fliQ)

This Recombinant Helicobacter pylori Flagellar biosynthetic protein FliQ (fliQ) spans the amino acid sequence from region 1-88.

Product Specifications

Product Name Alternative

Flagellar biosynthetic protein FliQ

UniProt

P0A0S3

Expression Region

1-88

Origin

Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESQLMKLAIETYKITLMISLPVLLAGLVVGLLVSIFQATTQINEMTLSFVPKILAVIGV LILTMPWMTNMLLDYTKTLIKLIPKIIG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP60 (LK1), CF594 conjugate, 0.1mg/mL
BNC940851-100 1x 100 µL

HSP60 (LK1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF647 conjugate, 0.1mg/mL
BNC470525-100 1x 100 µL

CD63 (MX-49.129.5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF640R conjugate, 0.1mg/mL
BNC400146-100 1x 100 µL

CD10 (CB-CALLA), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF405S conjugate, 0.1mg/mL
BNC040043-100 1x 100 µL

P21 / WAF1 (WA-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF594 conjugate, 0.1mg/mL
BNC940149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF594 conjugate, 0.1mg/mL