Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Alkaliphilus oremlandii ATP synthase subunit c (atpE)

This Recombinant Alkaliphilus oremlandii ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-88.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A8MJW4

Expression Region

1-88

Origin

Alkaliphilus oremlandii (strain OhILAs) (Clostridium oremlandii (strain OhILAs) )

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEGITGKELILAASAIGAGLAMIAGLGPGIGQGIAAGKGAEAVGRQPEAQGDILRTMLLG QAVAETTGIYSLVIALILLFANPLIRLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NIPA (ZC3HC1) (NM_016478) Human Tagged ORF Clone
RC204115 10 µg

NIPA (ZC3HC1) (NM_016478) Human Tagged ORF Clone

Sign In for Pricing
View Details
CD45RA (Leukocyte Common Antigen, LCA, Ly-5 T200 discontinued, see C2400-42J
C2400-41F1 100 µg

CD45RA (Leukocyte Common Antigen, LCA, Ly-5 T200 discontinued, see C2400-42J

Sign In for Pricing
View Details
FAM181A Protein Vector (Human) (pPM-C-HA)
PV015295 500 ng

FAM181A Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Ggn Mouse shRNA Plasmid (Locus ID 243897)
TR507428 1 Kit

Ggn Mouse shRNA Plasmid (Locus ID 243897)

Sign In for Pricing
View Details
Rose Bengal Sodium Salt, Technical Grade
TRC-R684900-25G 25 g

Rose Bengal Sodium Salt, Technical Grade

Sign In for Pricing
View Details
P22k15 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
35854066 1.0 µg DNA

P22k15 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details