Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Alkaliphilus oremlandii ATP synthase subunit c (atpE)

This Recombinant Alkaliphilus oremlandii ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-88.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A8MJW4

Expression Region

1-88

Origin

Alkaliphilus oremlandii (strain OhILAs) (Clostridium oremlandii (strain OhILAs) )

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEGITGKELILAASAIGAGLAMIAGLGPGIGQGIAAGKGAEAVGRQPEAQGDILRTMLLG QAVAETTGIYSLVIALILLFANPLIRLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Amphiregulin protein
orb1215871-01 5 µg

Human Amphiregulin protein

Sign In for Pricing
View Details
Human Amphiregulin protein
orb1215871-02 25 µg

Human Amphiregulin protein

Sign In for Pricing
View Details
Human POTEG Protein Lysate
MBS8417560-01 0.02 mg

Human POTEG Protein Lysate

Sign In for Pricing
View Details
Human POTEG Protein Lysate
MBS8417560-02 5x 0.02 mg

Human POTEG Protein Lysate

Sign In for Pricing
View Details
S-3-Amino-6,7-dihydroxy-hydrocoumarin Hydrochloride
465431-01 25 mg

S-3-Amino-6,7-dihydroxy-hydrocoumarin Hydrochloride

Sign In for Pricing
View Details
S-3-Amino-6,7-dihydroxy-hydrocoumarin Hydrochloride
465431-02 50 mg

S-3-Amino-6,7-dihydroxy-hydrocoumarin Hydrochloride

Sign In for Pricing
View Details