Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Alkaliphilus oremlandii ATP synthase subunit c (atpE)

This Recombinant Alkaliphilus oremlandii ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-88.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A8MJW4

Expression Region

1-88

Origin

Alkaliphilus oremlandii (strain OhILAs) (Clostridium oremlandii (strain OhILAs) )

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEGITGKELILAASAIGAGLAMIAGLGPGIGQGIAAGKGAEAVGRQPEAQGDILRTMLLG QAVAETTGIYSLVIALILLFANPLIRLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human GPR179 Protein
E30P2329 20 µg

Recombinant Human GPR179 Protein

Sign In for Pricing
View Details
NEDD8 Antibody Blocking peptide
orb1458375 500 µg

NEDD8 Antibody Blocking peptide

Sign In for Pricing
View Details
Recombinant Clostridium perfringens plc/Phospholipase C/Alpha-toxin Protein, C-His
orb2824242-01 20 µg

Recombinant Clostridium perfringens plc/Phospholipase C/Alpha-toxin Protein, C-His

Sign In for Pricing
View Details
Recombinant Clostridium perfringens plc/Phospholipase C/Alpha-toxin Protein, C-His
orb2824242-02 50 µg

Recombinant Clostridium perfringens plc/Phospholipase C/Alpha-toxin Protein, C-His

Sign In for Pricing
View Details
Recombinant Clostridium perfringens plc/Phospholipase C/Alpha-toxin Protein, C-His
orb2824242-03 100 µg

Recombinant Clostridium perfringens plc/Phospholipase C/Alpha-toxin Protein, C-His

Sign In for Pricing
View Details
Monoclonal Antibody to Tissue Inhibitors Of Metalloproteinase 1 (TIMP1)
TRV-0034009-01 20 µL

Monoclonal Antibody to Tissue Inhibitors Of Metalloproteinase 1 (TIMP1)

Sign In for Pricing
View Details