Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized membrane protein yfzA (yfzA)

This Recombinant Uncharacterized membrane protein yfzA (yfzA) spans the amino acid sequence from region 1-88.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yfzA

UniProt

C0H3X6

Expression Region

1-88

Origin

Bacillus subtilis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDKVYKRSWFQTFLAFLVSQLYFNFVELTGWGPKYREMNGFPANIVELDFFQTYLSFYDN PWFNIITVFLGVFTIIQIITGITKDIRN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Skin
CR563014 5 µg

Tissue Total RNA, Skin

Sign In for Pricing
View Details
CD14 (Monocyte / Macrophage Marker) (LPSR/2408), CF640R conjugate, 0.1mg/mL
BNC402408-100 1x 100 µL

CD14 (Monocyte / Macrophage Marker) (LPSR/2408), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ube2s Mouse Gene Knockout Kit (CRISPR)
KN518590 1 Kit

Ube2s Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PSTPIP1 (N-term) Rabbit Polyclonal Antibody
AP53492PU-N 400 µL

PSTPIP1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human CXCL12/SDF-1 Protein (aa22-89)
PKSH032296-01 10 µg

Recombinant Human CXCL12/SDF-1 Protein (aa22-89)

Sign In for Pricing
View Details
Recombinant Human CXCL12/SDF-1 Protein (aa22-89)
PKSH032296-02 50 µg

Recombinant Human CXCL12/SDF-1 Protein (aa22-89)

Sign In for Pricing
View Details