Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized membrane protein yfzA (yfzA)

This Recombinant Uncharacterized membrane protein yfzA (yfzA) spans the amino acid sequence from region 1-88.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yfzA

UniProt

C0H3X6

Expression Region

1-88

Origin

Bacillus subtilis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDKVYKRSWFQTFLAFLVSQLYFNFVELTGWGPKYREMNGFPANIVELDFFQTYLSFYDN PWFNIITVFLGVFTIIQIITGITKDIRN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Col10a1 Mouse Gene Knockout Kit (CRISPR)
KN503613 1 Kit

Col10a1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Vcan Mouse Gene Knockout Kit (CRISPR)
KN518868 1 Kit

Vcan Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CLIP3 Antibody
8C14917-AAT 50 µg

CLIP3 Antibody

Sign In for Pricing
View Details
DNA PKcs (PRKDC) pThr2609 Rabbit Polyclonal Antibody
AP02448PU-N 100 µL

DNA PKcs (PRKDC) pThr2609 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FNDC8 (NM_017559) Human Recombinant Protein
TP305252 20 µg

FNDC8 (NM_017559) Human Recombinant Protein

Sign In for Pricing
View Details
USP12 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A6]
TA800037BM 100 µL

USP12 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A6]

Sign In for Pricing
View Details