Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized membrane protein ydzK (ydzK)

This Recombinant Uncharacterized membrane protein ydzK (ydzK) spans the amino acid sequence from region 1-88.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein ydzK

UniProt

C0H3V4

Expression Region

1-88

Origin

Bacillus subtilis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVFILFYLWIVPIVIGILCSVAAHKSKGKMRVAPGIAMIVLSIISLITAFTAGHTNFHV FIGGMFLFGTFLVGSAFPFFFGLKKKEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TOR2A Antibody
A37242-100UL 100 µL

TOR2A Antibody

Sign In for Pricing
View Details
Anti-Human MRPS25 Polyclonal Antibody
HX992014-01 50 µg

Anti-Human MRPS25 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Human MRPS25 Polyclonal Antibody
HX992014-02 100 µg

Anti-Human MRPS25 Polyclonal Antibody

Sign In for Pricing
View Details
BNP Recombinant Rabbit mAb
BS49095-01 50 µL

BNP Recombinant Rabbit mAb

Sign In for Pricing
View Details
BNP Recombinant Rabbit mAb
BS49095-02 100 µL

BNP Recombinant Rabbit mAb

Sign In for Pricing
View Details
Sebacic Acid
30520-02 25 g

Sebacic Acid

Sign In for Pricing
View Details