Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized membrane protein ydzK (ydzK)

This Recombinant Uncharacterized membrane protein ydzK (ydzK) spans the amino acid sequence from region 1-88.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein ydzK

UniProt

C0H3V4

Expression Region

1-88

Origin

Bacillus subtilis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVFILFYLWIVPIVIGILCSVAAHKSKGKMRVAPGIAMIVLSIISLITAFTAGHTNFHV FIGGMFLFGTFLVGSAFPFFFGLKKKEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Meckel syndrome type 1 protein (MKS1) ELISA Kit
AE33409MO-01 48 Tests

Mouse Meckel syndrome type 1 protein (MKS1) ELISA Kit

Sign In for Pricing
View Details
Mouse Meckel syndrome type 1 protein (MKS1) ELISA Kit
AE33409MO-02 96 Tests

Mouse Meckel syndrome type 1 protein (MKS1) ELISA Kit

Sign In for Pricing
View Details
APC/Cy7 Linked Monoclonal Antibody to G Protein Coupled Receptor 35 (GPR35)
MBS2110493-01 0.1 mL

APC/Cy7 Linked Monoclonal Antibody to G Protein Coupled Receptor 35 (GPR35)

Sign In for Pricing
View Details
APC/Cy7 Linked Monoclonal Antibody to G Protein Coupled Receptor 35 (GPR35)
MBS2110493-02 0.2 mL

APC/Cy7 Linked Monoclonal Antibody to G Protein Coupled Receptor 35 (GPR35)

Sign In for Pricing
View Details
APC/Cy7 Linked Monoclonal Antibody to G Protein Coupled Receptor 35 (GPR35)
MBS2110493-03 0.5 mL

APC/Cy7 Linked Monoclonal Antibody to G Protein Coupled Receptor 35 (GPR35)

Sign In for Pricing
View Details
APC/Cy7 Linked Monoclonal Antibody to G Protein Coupled Receptor 35 (GPR35)
MBS2110493-04 1 mL

APC/Cy7 Linked Monoclonal Antibody to G Protein Coupled Receptor 35 (GPR35)

Sign In for Pricing
View Details