Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized membrane protein ydzK (ydzK)

This Recombinant Uncharacterized membrane protein ydzK (ydzK) spans the amino acid sequence from region 1-88.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein ydzK

UniProt

C0H3V4

Expression Region

1-88

Origin

Bacillus subtilis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVFILFYLWIVPIVIGILCSVAAHKSKGKMRVAPGIAMIVLSIISLITAFTAGHTNFHV FIGGMFLFGTFLVGSAFPFFFGLKKKEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hnrpll 3'UTR GFP Stable Cell Line
TU255884 1.0 mL

Hnrpll 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
ABP688
BA5575-10 10 mg

ABP688

Sign In for Pricing
View Details
Human Keyhole limpet hemocyanin ELISA Kit
GTR10359699 96 Well

Human Keyhole limpet hemocyanin ELISA Kit

Sign In for Pricing
View Details
KIAA1276 (FAM184B) (NM_015688) Human Tagged Lenti ORF Clone
RC227132L4 10 µg

KIAA1276 (FAM184B) (NM_015688) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
DDX18P3 sgRNA CRISPR Lentivector (Human) (Target 1)
K0572302 1.0 µg DNA

DDX18P3 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Buckle (Male/Female) for CXR100/CXR500 Soft Round Black Carrying case)
TW-372085 1 Unit

Buckle (Male/Female) for CXR100/CXR500 Soft Round Black Carrying case)

Sign In for Pricing
View Details