Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis SPBc2 prophage-derived protein BhlB (bhlB)

This Recombinant Bacillus subtilis SPBc2 prophage-derived protein BhlB (bhlB) spans the amino acid sequence from region 1-88.

Product Specifications

Product Name Alternative

SPBc2 prophage-derived protein BhlB

UniProt

O31984

Expression Region

1-88

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFENIDKGTIVRTLLLAIALLNQIMVMLGKAAFIINEEDINHLYDCLYTIFTIVFTTSTT TAAWFKNNYITAKGKKQKQVLKKENLFK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Soft tissue
CS714367 5x 5 µm

Tissue FFPE Sections, Soft tissue

Sign In for Pricing
View Details
MEF2A (Ab-408) Antibody
8B0019-AAT 50 µg

MEF2A (Ab-408) Antibody

Sign In for Pricing
View Details
SLAMF7 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5H5]
TA813790AM 100 µL

SLAMF7 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5H5]

Sign In for Pricing
View Details
Tissue FFPE Sections, Lymphoid tissue
CS802872 5x 5 µm

Tissue FFPE Sections, Lymphoid tissue

Sign In for Pricing
View Details
Hsp40 (DNAJB1) (1-70) Mouse Monoclonal Antibody [Clone ID: 2E1]
AM26593AF-N 100 µg

Hsp40 (DNAJB1) (1-70) Mouse Monoclonal Antibody [Clone ID: 2E1]

Sign In for Pricing
View Details
Mouse IgG (Immunoglobulin G) ELISA Kit
E-EL-M0692-01 24 Tests

Mouse IgG (Immunoglobulin G) ELISA Kit

Sign In for Pricing
View Details