Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis SPBc2 prophage-derived protein BhlB (bhlB)

This Recombinant Bacillus subtilis SPBc2 prophage-derived protein BhlB (bhlB) spans the amino acid sequence from region 1-88.

Product Specifications

Product Name Alternative

SPBc2 prophage-derived protein BhlB

UniProt

O31984

Expression Region

1-88

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFENIDKGTIVRTLLLAIALLNQIMVMLGKAAFIINEEDINHLYDCLYTIFTIVFTTSTT TAAWFKNNYITAKGKKQKQVLKKENLFK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kodaq 2X PCR MasterMix
G883 800 reactions (10 mL)

Kodaq 2X PCR MasterMix

Sign In for Pricing
View Details
Arginase 1 (Hepatocellular Carcinoma Marker) (ARG1/1125), CF647 conjugate, 0.1mg/mL
BNC471125-100 1x 100 µL

Arginase 1 (Hepatocellular Carcinoma Marker) (ARG1/1125), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
α, ω-Bis-Mercapto PEG
116000-40.5G 5 g

α, ω-Bis-Mercapto PEG

Sign In for Pricing
View Details
TAG-72 / CA72.4 (Tumor-Associated Glycoprotein) (rB72.3), CF647 conjugate, 0.1mg/mL
BNC473177-100 1x 100 µL

TAG-72 / CA72.4 (Tumor-Associated Glycoprotein) (rB72.3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
rac Secoisolariciresinol-d6
TRC-S239503-1MG 1 mg

rac Secoisolariciresinol-d6

Sign In for Pricing
View Details
Pyridoxine Cyclic Ether Impurity Hydrochloride Salt
TRC-P991740-25MG 25 mg

Pyridoxine Cyclic Ether Impurity Hydrochloride Salt

Sign In for Pricing
View Details