Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis SPBc2 prophage-derived protein BhlB (bhlB)

This Recombinant Bacillus subtilis SPBc2 prophage-derived protein BhlB (bhlB) spans the amino acid sequence from region 1-88.

Product Specifications

Product Name Alternative

SPBc2 prophage-derived protein BhlB

UniProt

O31984

Expression Region

1-88

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFENIDKGTIVRTLLLAIALLNQIMVMLGKAAFIINEEDINHLYDCLYTIFTIVFTTSTT TAAWFKNNYITAKGKKQKQVLKKENLFK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MLH1 (MutL Homolog 1) (MLH1/1324), 0.2mg/mL
BNUB1324-500 1x 500 µL

MLH1 (MutL Homolog 1) (MLH1/1324), 0.2mg/mL

Sign In for Pricing
View Details
Recombinant CD79b Monoclonal Antibody
AN301487L-01 50 µL

Recombinant CD79b Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant CD79b Monoclonal Antibody
AN301487L-02 100 µL

Recombinant CD79b Monoclonal Antibody

Sign In for Pricing
View Details
Polystyrene AM HMBA
H40014.100G 100 g

Polystyrene AM HMBA

Sign In for Pricing
View Details
CD31 / PECAM-1 (C31.10), CF647 conjugate, 0.1mg/mL
BNC470848-500 1x 500 µL

CD31 / PECAM-1 (C31.10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Wilm's Tumor 1 (WT1) (Wilm's Tumor & Mesothelial Marker), CF594 conjugate, 0.1mg/mL
BNC941665-500 1x 500 µL

Wilm's Tumor 1 (WT1) (Wilm's Tumor & Mesothelial Marker), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details