Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus phage SPbeta Protein bhlB (bhlB)

This Recombinant Bacillus phage SPbeta Protein bhlB (bhlB) spans the amino acid sequence from region 1-88.

Product Specifications

Product Name Alternative

Protein bhlB

UniProt

O64038

Expression Region

1-88

Origin

Bacillus phage SPbeta (Bacillus phage SPBc2) (Bacteriophage SP-beta)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFENIDKGTIVRTLLLAIALLNQIMVMLGKAAFIINEEDINHLYDCLYTIFTIVFTTSTT TAAWFKNNYITAKGKKQKQVLKKENLFK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GDPGP1 (NM_001013657) Human Recombinant Protein
TP312522L 1 mg

GDPGP1 (NM_001013657) Human Recombinant Protein

Sign In for Pricing
View Details
Rabbit Polyclonal S100P Antibody [Alexa Fluor 700]
NBP2-99514AF700 0.1 mL

Rabbit Polyclonal S100P Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
GLIS2 Protein Lysate (Rat) with C-HA Tag
21607036 100 µg

GLIS2 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
PLB1 Recombinant Protein
OPCD06258-50UG 50 µg

PLB1 Recombinant Protein

Sign In for Pricing
View Details
Tspan33 3'UTR Luciferase Stable Cell Line
TU121249 1.0 mL

Tspan33 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
TentaGel® HL OH
HL12130.5G 5 g

TentaGel® HL OH

Sign In for Pricing
View Details