Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus phage SPbeta Protein bhlB (bhlB)

This Recombinant Bacillus phage SPbeta Protein bhlB (bhlB) spans the amino acid sequence from region 1-88.

Product Specifications

Product Name Alternative

Protein bhlB

UniProt

O64038

Expression Region

1-88

Origin

Bacillus phage SPbeta (Bacillus phage SPBc2) (Bacteriophage SP-beta)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFENIDKGTIVRTLLLAIALLNQIMVMLGKAAFIINEEDINHLYDCLYTIFTIVFTTSTT TAAWFKNNYITAKGKKQKQVLKKENLFK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MuRF3 (B-2) Alexa Fluor® 594
sc-166137 AF594 200 µg/mL

MuRF3 (B-2) Alexa Fluor® 594

Sign In for Pricing
View Details
ZNF189 Polyclonal Antibody
MBS8571103-01 0.1 mL

ZNF189 Polyclonal Antibody

Sign In for Pricing
View Details
ZNF189 Polyclonal Antibody
MBS8571103-02 0.1 mL (AF405L)

ZNF189 Polyclonal Antibody

Sign In for Pricing
View Details
ZNF189 Polyclonal Antibody
MBS8571103-03 0.1 mL (AF405S)

ZNF189 Polyclonal Antibody

Sign In for Pricing
View Details
ZNF189 Polyclonal Antibody
MBS8571103-04 0.1 mL (AF610)

ZNF189 Polyclonal Antibody

Sign In for Pricing
View Details
ZNF189 Polyclonal Antibody
MBS8571103-05 0.1 mL (AF635)

ZNF189 Polyclonal Antibody

Sign In for Pricing
View Details