Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant His1 virus Putative transmembrane protein ORF24 (ORF24)

This Recombinant His1 virus Putative transmembrane protein ORF24 (ORF24) spans the amino acid sequence from region 1-88.

Product Specifications

Product Name Alternative

Putative transmembrane protein ORF24

UniProt

Q25BH1

Expression Region

1-88

Origin

His1 virus (isolate Australia/Victoria) (His1V) (Haloarcula hispanica virus 1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMLQTAFTDLANPSYLNMGLALLLATIMVMILWAGMRLKSPAVFVIWALTSITLIFTFVT QFSFIWFWVMVMLSLLLISIVASIRYTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11c (HC1/1), CF740 conjugate, 0.1mg/mL
BNC740152-100 1x 100 µL

CD11c (HC1/1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF405S conjugate, 0.1mg/mL
BNC040304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF640R conjugate, 0.1mg/mL
BNC400645-500 1x 500 µL

FOXP3 (3G3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF488A conjugate, 0.1mg/mL
BNC880218-500 1x 500 µL

CD100 (Semaphorin-4D) (A8), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (T-Cell Marker) (rSPN/839), CF405S conjugate, 0.1mg/mL
BNC042220-500 1x 500 µL

CD43 (T-Cell Marker) (rSPN/839), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 5/8 (C-50), CF594 conjugate, 0.1mg/mL
BNC940948-500 1x 500 µL

Cytokeratin 5/8 (C-50), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details